![]() | DhR8C |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 62 aa |
| Mass | 6.79 kD |
| ext | 1490 |
| pI | 5.16 |
| Name | Putative uncharacterized protein |
| P Number | P000010389 |
| Database References | NCBI UniProt |
| PFAM | PF07873 |
| PDB Structures | 2KS0 (NMR) 2KYI (NMR) 3IPF (Xray) |
| Date Purified | 2008-09-02 |
|---|---|
| Setup Date | 2008-09-12 |
| ExpMolecularWeight | 7856.9 |
| Volume | 450.0 µL |
| Concentration | 8.0 mg/mL |
| Gene | |
|---|---|
| Organism | Desulfitobacterium hafniense |
| Genus | Desulfitobacterium |
| Species | hafniense |
| Strain | |
| Sequence | DNRQFLSLTGVSKVQSFDPKEILLETIQGVLSIKGEKLGIKHLDLKAGQVEVEGLIDALVYP |