![]() | ErR2A |
|---|---|
| Spine Status | HSQC collected |
| Length | 118 aa |
| Mass | 13.11 kD |
| ext | 15930 |
| pI | 4.70 |
| Name | NA |
| P Number | P000011488 |
| Database References | NCBI UniProt |
| PFAM | PF00717 |
| PDB Structures | 1UMU (Best Match) |
| Date Purified | 2009-08-03 |
|---|---|
| Setup Date | 2009-08-17 |
| ExpMolecularWeight | 14566.8 |
| Volume | 450.0 µL |
| Concentration | 8.4 mg/mL |
| Gene | |
|---|---|
| Organism | Clostridium leptum |
| Genus | Eubacterium |
| Species | rectale |
| Strain | |
| Sequence | VSAGTGNYLEDSVKETYDVGHLAPEQTDFGVRISGDSMEPLYHTDDVAWIQKKDSLANGEIGIFYLNGNTYIKELHDEPDGVYLISLNQKYRPIQVLESDSFKIFGKVIGKCKGAEIP |