![]() | HR3035C |
|---|---|
| Spine Status | HSQC collected |
| Length | 143 aa |
| Mass | 16.70 kD |
| ext | 11460 |
| pI | 5.36 |
| Name | RecName: Full=Sorting nexin-6;AltName: Full=TRAF4-associated factor 2; |
| P Number | P000011661 |
| Database References | NCBI UniProt |
| PFAM | PF00787 |
| PDB Structures | 3HPC (Best Match) |
| Date Purified | 2009-09-23 |
|---|---|
| Setup Date | 2009-10-05 |
| ExpMolecularWeight | 20539.2 |
| Volume | 450.0 µL |
| Concentration | 10.0 mg/mL |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | ALQVDISDALSERDKVKFTVHTKSSLPNFKQNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKEEFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLEYNQDL |