![]() | JR30 |
|---|---|
| Spine Status | good HSQC collected |
| Length | 161 aa |
| Mass | 17.97 kD |
| ext | 11460 |
| pI | 9.26 |
| Name | UPF0129 protein PH0709 |
| P Number | P000011844 |
| Database References | NCBI UniProt |
| PFAM | PF08745 |
| PDB Structures | 2LCQ (Best Match) |
| Date Purified | 2005-05-16 |
|---|---|
| Setup Date | 2009-12-01 |
| ExpMolecularWeight | 19083.8 |
| Volume | 450.0 µL |
| Concentration | 7.7 mg/mL |
| Gene | |
|---|---|
| Organism | Pyrococcus horikoshii |
| Genus | Pyrococcus |
| Species | horikoshi |
| Strain | |
| Sequence | MLRNLKKTLVLDSSVFIQGIDIEGYTTPSVVEEIKDRESKIFLESLISAGKVKIAEPSKESIDRIIQVAKETGEVNELSKADIEVLALAYELKGEIFSDDYNVQNIASLLGLRFRTLKRGIKKVIKWRYVCIGCGRKFSTLPPGGVCPDCGSKVKLIPRKR |