X000011678
 | HR5541B |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 130 aa |
| Mass | 15.08 kD |
| ext | 23950 |
| pI | 5.61 |
| Name | RecName: Full=Signal transducer and activator of transcription 5B; |
| P Number | P000011997 |
| Database References | NCBI UniProt |
| PFAM | PF02864 |
| PDB Structures | 4ZIA (Best Match) |
| Date Purified | 2009-12-07 |
|---|---|
| Setup Date | 2009-12-17 |
| ExpMolecularWeight | 16247.5 |
| Volume | 450.0 µL |
| Concentration | 9.1 mg/mL |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPA |