X000007423
 | SfR140 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 128 aa |
| Mass | 14.37 kD |
| ext | 20970 |
| pI | 4.35 |
| Name | Putative tail component of prophage CP-933K |
| P Number | P000007456 |
| Database References | NCBI UniProt |
| PFAM | PF06894 |
| PDB Structures |
| Date Purified | 2006-05-31 |
|---|---|
| Setup Date | 2006-08-25 |
| ExpMolecularWeight | 15671.5 |
| Volume | 450.0 µL |
| Concentration | 7.0 mg/mL |
| Gene | |
|---|---|
| Organism | Shigella flexneri |
| Genus | Shigella |
| Species | flexneri |
| Strain | |
| Sequence | MFLKQDTFNYEKQSVVLSELSGLQRIEYLTFVQQRTAKFDAQEGELPEAERQIAFLRMGMDINAWLVSRSLWNAEQSQDVETLCASIMTTWSYDALGAGAERVLSLSGMGTIENAGDDDHEALTPEKS |