| Read Date | 2007-11-29 11:01:00 |
|---|---|
| Read Number | X0000094950994200711291101 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | crystal |
| Cocktail | 8_C0837 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Manganese sulfate monohydrate | 6.0 | 0.1 M | [Mn+2].[O-]S([O-])(=O)=O.… |
| PEG 1000 | 6.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| MES monohydrate | 6.0 | 0.1 M | O=S(=O)(O)CCN1CCOCC1 |
![]() | SfR311 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 159 aa |
| Mass | 17.60 kD |
| ext | 12950 |
| pI | 5.18 |
| Name | Hypothetical protein |
| Database References | NCBI UniProt |
| PFAM | PF10662 |
| PDB Structures | 3K53 (Best Match) |
| Gene | |
|---|---|
| Organism | Shigella flexneri |
| Genus | Shigella |
| Species | flexneri |
| Strain | |
| Sequence | MKRIAFVGSVGAGKTTLFNALQGNYTLARKTLAVEFNDKGDIDTPGEYFSHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGFEEPIFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE |