| Read Date | 2008-01-18 08:23:00 |
|---|---|
| Read Number | X0000096171249200801180823 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C0169 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium molybdate dihydrate | 7.0 | 1.4 M | [Na+].[O-]C(=O)CCCCCCC(O)… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | BfR205 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 117 aa |
| Mass | 12.54 kD |
| ext | 9970 |
| pI | 5.44 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF07883 |
| PDB Structures | 3CEW (Xray) |
| Gene | |
|---|---|
| Organism | Bacteroides fragilis |
| Genus | Bacteroides |
| Species | fragilis |
| Strain | |
| Sequence | MKNYQKMSVAQDARVELHDSLALTGAEVSINHLPAGAGVPFVHSHKQNEEIYGILSGKGFITIDGEKIELQAGDWLRIAPDGKRQISAASDSPIGFLCIQVKAGSLEGYTMTDGVVQ |