| Read Date | 2008-01-18 08:25:00 |
|---|---|
| Read Number | X0000096171073200801180825 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C0161 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 6.5 | 0.7 M | [Na+].[O-]C(=O)C.O.O.O |
| Imidazole | 6.5 | 0.1 M | c1cnc[nH]1 |
| Glycerol anhydrous | 6.5 | 30.0 % (v/v) | C(C(CO)O)O |
![]() | BfR205 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 117 aa |
| Mass | 12.54 kD |
| ext | 9970 |
| pI | 5.44 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF07883 |
| PDB Structures | 3CEW (Xray) |
| Gene | |
|---|---|
| Organism | Bacteroides fragilis |
| Genus | Bacteroides |
| Species | fragilis |
| Strain | |
| Sequence | MKNYQKMSVAQDARVELHDSLALTGAEVSINHLPAGAGVPFVHSHKQNEEIYGILSGKGFITIDGEKIELQAGDWLRIAPDGKRQISAASDSPIGFLCIQVKAGSLEGYTMTDGVVQ |