| Read Date | 2008-01-18 10:01:00 |
|---|---|
| Read Number | X0000096211377200801181001 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C0093 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Manganese chloride tetrahydrate | 5.0 | 1.3 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | RR365 |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 159 aa |
| Mass | 18.20 kD |
| ext | 42970 |
| pI | 4.65 |
| Name | Putative polyketide cyclase (WhiE ORF VI) |
| Database References | NCBI UniProt |
| PFAM | PF03364 |
| PDB Structures | 2KF2 (NMR) |
| Gene | |
|---|---|
| Organism | Streptomyces coelicolor |
| Genus | Streptomyces |
| Species | coelicolor |
| Strain | |
| Sequence | MAGHTDNEITIAAPMELVWNMTNDIEKWPGLFSEYASVEVLGRDDDKVTFRLTMHPDADGKVWSWVSERVADPVTRTVRAQRVETGPFQYMNIVWEYAETAEGTVMRWTQDFAMKPDAPVDDAWMTDNINRNSRTQMALIRDRIEQAAGERRTASVLAD |