| Read Date | 2008-01-24 10:20:00 |
|---|---|
| Read Number | X0000096411088200801241020 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C1124 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.6 | 1.6 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic trihydrate | 5.6 | 0.2 M | [K+].O.O.O.[K+].[O-]P([O-… |
![]() | BtR268 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 202 aa |
| Mass | 23.42 kD |
| ext | 21890 |
| pI | 5.80 |
| Name | Thiamine phosphate pyrophosphorylase |
| Database References | NCBI UniProt |
| PFAM | PF02581 |
| PDB Structures | 3CEU (Xray) |
| Gene | |
|---|---|
| Organism | Bacteroides thetaiotaomicron |
| Genus | Bacteroides |
| Species | thetaiotaomicron |
| Strain | |
| Sequence | MKLIVVTTPTFFVEEDKIITALFEEGLDILHLRKPETPAMYSERLLTLIPEKYHRRIVTHEHFYLKEEFNLMGIHLNARNPSEPHDYAGHVSCSCHSVEEVKNRKHFYDYVFMSPIYDSISKVNYYSTYTAEELREAQKAKIIDSKVMALGGINEDNLLEIKDFGFGGAVVLGDLWNKFDACLDQNYLAVIEHFKKLKKLAD |