| Read Date | 2008-01-24 09:55:00 |
|---|---|
| Read Number | X0000096421363200801240955 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C0281 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Potassium phosphate monobasic | 8.0 | 0.1 M | [K+].[O-]P(=O)(O)O |
| PEG 20000 | 8.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | BtR256 |
|---|---|
| Spine Status | aggregation screening |
| Length | 242 aa |
| Mass | 27.45 kD |
| ext | 29910 |
| pI | 5.82 |
| Name | Pyruvate formate-lyase activating enzyme |
| Database References | NCBI UniProt |
| PFAM | PF04055 |
| PDB Structures | 3CB8 (Best Match) |
| Gene | |
|---|---|
| Organism | Bacteroides thetaiotaomicron |
| Genus | Bacteroides |
| Species | thetaiotaomicron |
| Strain | |
| Sequence | MMINVHSYESMGTFDGPGLRLVVFLQGCNFRCLYCANPDTIAGKGGTPTPPEEIVRMAMSQRPFFGKRGGITFSGGEPTFQAKALVPLVRELKERGIHVCLDSNGGLWNEDVEELFKLTDLVLLDIKEFNPNRHQTLTGRSNEQTIRTAAWLEEQGKPFWLRYVLVPGYSDFEEDIRALGEALGKYKMIQRVEILPYHTLGVHKYEAMGQEYKMKGVKENTPEQLEKAAEVFKEYFTTVVVN |