| Read Date | 2008-01-24 11:29:00 |
|---|---|
| Read Number | X0000096451471200801241129 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | crystal |
| Cocktail | 8_C0380 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Lithium sulfate monohydrate | 7.0 | 0.1 M | [Li+].[Li+].[O-]S([O-])(=… |
| PEG 20000 | 7.0 | 40.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | BtR265 |
|---|---|
| Spine Status | crystal hits |
| Length | 262 aa |
| Mass | 29.22 kD |
| ext | 34380 |
| pI | 4.84 |
| Name | Xylanase |
| Database References | NCBI UniProt |
| PFAM | PF00326 |
| PDB Structures | 3HXK (Best Match) |
| Gene | |
|---|---|
| Organism | Bacteroides thetaiotaomicron |
| Genus | Bacteroides |
| Species | thetaiotaomicron |
| Strain | |
| Sequence | MKKLICISLYEDLSMTTYDLSKVDNAELIGIVENASEGTLFVFTCDRPNGSSVIMCPGGGFLKTNLENEGIDFAEWFTKLGITYIVFKYRMPHGNPDVPEQDTRLALKVVREKFPEFCDKLGVMGASIGGYLATFSATLLPDDEKPDFQILMYPVVSVDDRLTHFPCRERMFGHSYSPDKMEQYSPIEHITSGTPAAFIVAAADDAVVSPLNGIMYAARLQKADIPISLHIYPAGGHGFGYNDSFVYKQEWLQELGEWLAKL |