| Read Date | 2008-01-24 14:34:00 |
|---|---|
| Read Number | X0000096481534200801241434 |
| Week | 1 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | phase |
| Cocktail | 8_C1344 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| PEG 20000 | 9.0 | 10.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bicine | 9.0 | 0.1 M | O=C(O)CN(CCO)CCO |
| 1,4-Dioxane | 9.0 | 2.0 % (v/v) | O1CCOCC1 |
![]() | EfR155 |
|---|---|
| Spine Status | aggregation screening |
| Length | 195 aa |
| Mass | 20.90 kD |
| ext | 4470 |
| pI | 4.75 |
| Name | Putative uncharacterized protein |
| Database References | UniProt |
| PFAM | PF01206 |
| PDB Structures | 3HZ7 (Best Match) |
| Gene | |
|---|---|
| Organism | Enterococcus faecalis |
| Genus | Enterococcus |
| Species | faecalis |
| Strain | |
| Sequence | MKLVDALGKPCPIPVIETKKALAELGLAGGTIEVLVDNEVAIENLKKLATKKQATLTAKQIEATVFSVKITVPEEATQQTSQSATDLVITIGSDQLGTGDEQLGRLLMKSYLQSLSEAETVPTQLLFFNRGAFLTNQAANTLADLQQLAEKGTTIQTCGACLDFYHLTDTLAIGSITNMYEIVETMNQAAKVITL |