| Read Date | 2008-01-24 12:06:00 |
|---|---|
| Read Number | X0000096491052200801241206 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C1415 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium chloride | 6.5 | 0.2 M | [Na+].[Cl-] |
| Bis-Tris | 6.5 | 0.1 M | OCCN(C(CO)(CO)CO)CCO |
| PEG 3350 | 6.5 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | BhR186 |
|---|---|
| Spine Status | crystal hits |
| Length | 197 aa |
| Mass | 21.56 kD |
| ext | 9970 |
| pI | 6.91 |
| Name | Dipicolinate synthase subunit B |
| Database References | NCBI UniProt |
| PFAM | PF02441 |
| PDB Structures | 3LQK (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus halodurans |
| Genus | Bacillus |
| Species | halodurans |
| Strain | |
| Sequence | MNFAGKHVGFGLTGSHCTYHEVLPQMERLVELGAKVTPFVTHTVQTTDTKFGESSEWINKIKQITEEPIVDSMVKAEPFGPKTPLDCMVIAPMTGNSTSKFANAMTDSPVLMGAKATLRNGKPVVVGISTNDALGLNGINIMRLMATKNIYFIPFGQDNPQVKPNSLVARMEALPETIEAALRGQQYQPVLIEKFRD |