| Read Date | 2008-02-05 10:04:00 |
|---|---|
| Read Number | X0000096671180200802051004 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C1039 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.0 | 1.0 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 5.0 | 0.0 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SmR83 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 210 aa |
| Mass | 23.71 kD |
| ext | 10430 |
| pI | 5.02 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF04263 |
| PDB Structures | 3IHK (Xray) |
| Gene | |
|---|---|
| Organism | Streptococcus mutans |
| Genus | Streptococcus |
| Species | mutans |
| Strain | |
| Sequence | MTKVALFSGGDLTYFTRDFDYFVGIDKGSSFLLKNQLPLDLAIGDFDSVSAEEFKQIKAKAKKLVMAPAEKNDTDTELALKTIFDCFGRVEIIVFGAFGGRIDHMLSNIFLPSDPDLAPFMRCFKLRDEQNLVEFFPAGQHQIEQATDMVYISFMAANGAHLSIQDAKYELTEENYFQKKIYSSNEFKDKPICFSVASGYVVVIQTKDRT |