| Read Date | 2008-02-05 10:49:00 |
|---|---|
| Read Number | X0000096721477200802051049 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | other |
| 10-Way Classifier | precip |
| Cocktail | 8_C0190 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Sodium thiosulfate pentahydrate | 8.0 | 2.8 M | [Na+].[Na+].[O-]S([O-])(=… |
![]() | LpR114 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 219 aa |
| Mass | 24.12 kD |
| ext | 32430 |
| pI | 4.78 |
| Name | Putative uncharacterized protein lp_1622 |
| Database References | NCBI UniProt |
| PFAM | PF04263 |
| PDB Structures | 3CQ9 (Xray) |
| Gene | |
|---|---|
| Organism | Lactobacillus plantarum |
| Genus | Lactobacillus |
| Species | plantarum |
| Strain | |
| Sequence | MATIVNLLVGGPTANYPADLTTIPGPWVGADRGALRLVKRGIQPVMVVGDFDSIDAAELQTVKDALVGAIVVKPDQDHTDTQLAIKSIFEQLQPDEVHLYGATGGRLDHLLANMWLVLDPVFRQWAPQIKLIDKQNSVRFFLPGDYQITKEADKRYLAFVPLMPMHLTLPDEKYQLDAAYNAYPISWASNEFSGNTGHFSFDAGVLAVIQSRDDSMADA |