| Read Date | 2008-02-05 10:50:00 |
|---|---|
| Read Number | X0000096721440200802051050 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C1440 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium bromide | 6.5 | 0.2 M | [K+].[Br-] |
| PEG MME 2000 | 6.5 | 30.0 % (w/v) | COCCOCOCCOCOCCOCOCCOCOCCO… |
![]() | LpR114 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 219 aa |
| Mass | 24.12 kD |
| ext | 32430 |
| pI | 4.78 |
| Name | Putative uncharacterized protein lp_1622 |
| Database References | NCBI UniProt |
| PFAM | PF04263 |
| PDB Structures | 3CQ9 (Xray) |
| Gene | |
|---|---|
| Organism | Lactobacillus plantarum |
| Genus | Lactobacillus |
| Species | plantarum |
| Strain | |
| Sequence | MATIVNLLVGGPTANYPADLTTIPGPWVGADRGALRLVKRGIQPVMVVGDFDSIDAAELQTVKDALVGAIVVKPDQDHTDTQLAIKSIFEQLQPDEVHLYGATGGRLDHLLANMWLVLDPVFRQWAPQIKLIDKQNSVRFFLPGDYQITKEADKRYLAFVPLMPMHLTLPDEKYQLDAAYNAYPISWASNEFSGNTGHFSFDAGVLAVIQSRDDSMADA |