| Read Date | 2005-10-14 08:12:00 |
|---|---|
| Read Number | X0000059241222200510140812 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1230 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium chloride | 9.0 | 1.0 M | [Na+].[Cl-] |
| Bicine | 9.0 | 0.1 M | O=C(O)CN(CCO)CCO |
![]() | SaR11 |
|---|---|
| Spine Status | aggregation screening |
| Length | 296 aa |
| Mass | 33.98 kD |
| ext | 31860 |
| pI | 6.39 |
| Name | tRNA delta(2)-isopentenylpyrophosphate transferase (EC 2.5.1.8) (IPPtransferase) (Isopentenyl-diphosphate:tRNA isopentenyltransferase)(IPTase) (IPPT) |
| Database References | NCBI UniProt |
| PFAM | PF01715 |
| PDB Structures | 3EXA (Best Match) |
| Gene | |
|---|---|
| Organism | Streptococcus agalactiae |
| Genus | Streptococcus |
| Species | agalactiae |
| Strain | |
| Sequence | MRKIKLIAVVGPTAVGKTALGIELAKTFNGEIISGDSQQVYQKLDIGTAKASKEEQEQAYHHLIDVREVNENYSVYDFVKEAKVAIDTIISKGKIPIIVGGTGLYLQSLFEGYHLGGEVNQETLMAYREKLESLSDEDLFEKLTEQSIIIPQVNRRRAIRALELAKFGNDLQNSESPYDVLLIGLNDDRQVLYDRINRRVDLMMDNGLLDEAKWLYDNYPSVQASKGIGYKELFPYFSKQIPLEEAVDKLKQNTRRFAKRQLTWFRNRMNVEFIMVGEENYQQKIKRKVSDFLSSK |