| Read Date | 2008-02-29 07:41:00 |
|---|---|
| Read Number | X0000097591280200802290741 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C1136 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium chloride | 5.0 | 2.0 M | [Na+].[Cl-] |
| Citric acid | 5.0 | 0.1 M | C(C(=O)O)C(CC(=O)O)(C(=O)… |
![]() | KR108 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 268 aa |
| Mass | 30.79 kD |
| ext | 68870 |
| pI | 5.72 |
| Name | Sugar hydrolase |
| Database References | NCBI UniProt |
| PFAM | PF12695 |
| PDB Structures | 3HXK (Xray) |
| Gene | |
|---|---|
| Organism | Lactococcus lactis |
| Genus | Lactococcus |
| Species | lactis |
| Strain | |
| Sequence | MIFLSTLFWYNKLMNKSTFSLNDTAWVDFYQLQNPRQNENYTFPAIIICPGGGYQHISQRESDPLALAFLAQGYQVLLLNYTVMNKGTNYNFLSQNLEEVQAVFSLIHQNHKEWQINPEQVFLLGCSAGGHLAAWYGNSEQIHRPKGVILCYPVTSFTFGWPSDLSHFNFEIENISEYNISEKVTSSTPPTFIWHTADDEGVPIYNSLKYCDRLSKHQVPFEAHFFESGPHGVSLANRTTAPSDAYCLPSVHRWVSWASDWLERQIKN |