| Read Date | 2008-03-07 09:04:00 |
|---|---|
| Read Number | X0000097781348200803070904 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8_C1045 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.0 | 1.4 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 5.0 | 0.0 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SyR86 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 211 aa |
| Mass | 23.88 kD |
| ext | 17420 |
| pI | 5.26 |
| Name | Putative thiamine pyrophosphokinase |
| Database References | NCBI UniProt |
| PFAM | PF04263 |
| PDB Structures | 3L8M (Xray) |
| Gene | |
|---|---|
| Organism | Staphylococcus saprophyticus |
| Genus | Staphylococcus |
| Species | saprophyticus |
| Strain | |
| Sequence | MKANLLCGNRNLPKHILVEHKHEHWIGIDRGTLILLESGITPQFAVGDFDSISDSERNFIQQQIEINPYNSEKDDTDLALGIDQAVKRGYRNIDVYGATGGRLDHFMGALQILEKPEYAKMNINIKLIDDTNEIQFIQKGQFNVTYSEQFPYISFIPVIYPTVISLKGFKYNLQNETLKLGSTLTISNELSQSCGNIEIIEGSVLMIRSKD |