 
    | Read Date | 2008-03-07 09:04:00 | 
|---|---|
| Read Number | X0000097781352200803070904 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8_C1046 | 
| Screen | HWI Generation 8 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 5.6 | 1.3 M | [Na+].[O-]P(=O)(O)O.O | 
| Potassium phosphate dibasic anhydrous | 5.6 | 0.1 M | [K+].[K+].[O-]P([O-])(=O)… | 
|  | SyR86 | 
|---|---|
| Spine Status | X-Ray structure | 
| Length | 211 aa | 
| Mass | 23.88 kD | 
| ext | 17420 | 
| pI | 5.26 | 
| Name | Putative thiamine pyrophosphokinase | 
| Database References | NCBI UniProt | 
| PFAM | PF04263 | 
| PDB Structures | 3L8M (Xray) | 
| Gene | |
|---|---|
| Organism | Staphylococcus saprophyticus | 
| Genus | Staphylococcus | 
| Species | saprophyticus | 
| Strain | |
| Sequence | MKANLLCGNRNLPKHILVEHKHEHWIGIDRGTLILLESGITPQFAVGDFDSISDSERNFIQQQIEINPYNSEKDDTDLALGIDQAVKRGYRNIDVYGATGGRLDHFMGALQILEKPEYAKMNINIKLIDDTNEIQFIQKGQFNVTYSEQFPYISFIPVIYPTVISLKGFKYNLQNETLKLGSTLTISNELSQSCGNIEIIEGSVLMIRSKD |