| Read Date | 2008-03-24 12:19:00 |
|---|---|
| Read Number | X0000097960327200803241219 |
| Week | 1 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | phase |
| Cocktail | 8_C0310 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium formate | 8.5 | 3.6 M | [Na+].[O-]C=O |
| Glycerol anhydrous | 8.5 | 10.0 % (v/v) | C(C(CO)O)O |
![]() | CfR4 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 140 aa |
| Mass | 15.48 kD |
| ext | 5960 |
| pI | 5.68 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF09391 |
| PDB Structures |
| Gene | |
|---|---|
| Organism | Clostridium difficile |
| Genus | Clostridium |
| Species | difficile |
| Strain | |
| Sequence | MENKNSKCVMVIDENLPMGIISNTAAIMGITLGKHAPETVGPDVIDKTGNSHLGIIDIPVPILKGNKEIIKDLRKKLYTLEFNDLTVVDFSDVAQSCNLYEEFTQKIASVPEDELQYFGIAIYGNKKKVNKLTGSMPLLR |