| Read Date | 2008-03-24 10:32:00 |
|---|---|
| Read Number | X0000097981373200803241032 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C0092 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.2 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Manganese chloride tetrahydrate | 4.2 | 1.3 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | CmR3 |
|---|---|
| Spine Status | HSQC collected |
| Length | 139 aa |
| Mass | 15.66 kD |
| ext | 11460 |
| pI | 5.07 |
| Name | Mov34/MPN/PAD-1 |
| Database References | NCBI UniProt |
| PFAM | PF14464 |
| PDB Structures | 2KKS (Best Match) |
| Gene | |
|---|---|
| Organism | Clostridium thermocellum |
| Genus | Clostridium |
| Species | thermocellum |
| Strain | |
| Sequence | MIVMTKQQYQEILEHSRNALPNEACGLLGGRIENGVKYVEKVYLLRNIDESPEHFSMNPKEQFAAVKDMRNNGWELLGNFHSHPATPSRPSEEDIRLAFDPKASYLILSLKDDTPVLKSFNISSGQATQEELSIVGEEA |