| Read Date | 2008-03-28 07:25:00 |
|---|---|
| Read Number | X0000098031144200803280725 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C1510 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 4.6 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Lithium sulfate monohydrate | 4.6 | 1.5 M | [Li+].[Li+].[O-]S([O-])(=… |
![]() | TaR80B |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 98 aa |
| Mass | 10.81 kD |
| ext | 7450 |
| pI | 5.71 |
| Name | Hypothetical protein Ta0387 |
| Database References | NCBI UniProt |
| PFAM | |
| PDB Structures | 2K75 (NMR) |
| Gene | |
|---|---|
| Organism | Thermoplasma acidophilum |
| Genus | Thermoplasma |
| Species | acidophilum |
| Strain | |
| Sequence | SDLVKIRDVSLSTPYVSVIGKITGIHKKEYESDGTTKSVYQGYIEDDTARIRISSFGKQLQDSDVVRIDNARVAQFNGYLSLSVGDSSRIESVNVNIP |