| Read Date | 2008-04-04 07:17:00 |
|---|---|
| Read Number | X0000098071392200804040717 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C1056 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 8.2 | 0.1 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 8.2 | 1.7 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | IR191 |
|---|---|
| Spine Status | HSQC collected |
| Length | 155 aa |
| Mass | 17.86 kD |
| ext | 30940 |
| pI | 6.28 |
| Name | Anaerobic ribonucleoside-triphosphate reductase-activating protein(EC 1.97.1.-) (Class III anaerobic ribonucleotide reductase smallcomponent) |
| Database References | NCBI UniProt |
| PFAM | PF13353 |
| PDB Structures | 3CB8 (Best Match) |
| Gene | |
|---|---|
| Organism | Haemophilus influenzae |
| Genus | Haemophilus |
| Species | influenzae |
| Strain | |
| Sequence | MNYLQYYPTDVINGEGTRCTLFVSGCTHACKGCYNQKSWSFSAGVLFDDVMEQQIINDLKDTRIKRQGLTLSGGDPLHPLNVETLLPFVQRVKRECPDKDIWVWTGYKLDELDKQQRAMLPYIDVLIDGKFIQEQADPSLVWRGSANQIIHRFKL |