| Read Date | 2008-04-17 11:09:00 |
|---|---|
| Read Number | X0000098141477200804171109 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C0190 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Sodium thiosulfate pentahydrate | 8.0 | 2.8 M | [Na+].[Na+].[O-]S([O-])(=… |
![]() | EwR156A |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 66 aa |
| Mass | 7.34 kD |
| ext | 8480 |
| pI | 9.05 |
| Name | Putative cold-shock protein |
| Database References | NCBI UniProt |
| PFAM | PF00313 |
| PDB Structures | 2K5N (NMR) 2N49 (NMR) |
| Gene | |
|---|---|
| Organism | Erwinia carotovora |
| Genus | Pectobacterium |
| Species | carotovorum |
| Strain | |
| Sequence | MAMNGTITTWFKDKGFGFIKDENGDNRYFHVIKVANPDLIKKDAAVTFEPTTNNKGLSAYAVKVVP |