| Read Date | 2008-04-24 10:55:00 |
|---|---|
| Read Number | X0000098211114200804241055 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8_C1311 |
| Screen | HWI Generation 8 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 5.6 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Ammonium sulfate | 5.6 | 0.5 M | O=S(=O)(O)O.N.N |
| Lithium sulfate monohydrate | 5.6 | 1.0 M | [Li+].[Li+].[O-]S([O-])(=… |
![]() | BcR191B |
|---|---|
| Spine Status | HSQC collected |
| Length | 103 aa |
| Mass | 11.47 kD |
| ext | 6990 |
| pI | 4.44 |
| Name | SSU ribosomal protein S1P |
| Database References | NCBI UniProt |
| PFAM | PF00575 |
| PDB Structures | 1SRO (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus cereus |
| Genus | Bacillus |
| Species | cereus |
| Strain | |
| Sequence | MVEKMNEEVMDSKELQVGDVVTGSVTKVEEKQVLVNVGYKTDGVIPISELANVHIEKASDVVELDQTLELKIIKLEEDDLVLSKRAVDAEKAWVELQEKFTSG |