| Read Date | 2008-05-08 12:32:00 |
|---|---|
| Read Number | X0000099401373200805081232 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8A_C0092 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.2 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Manganese chloride tetrahydrate | 4.2 | 1.3 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | SR577A |
|---|---|
| Spine Status | X-Ray structure |
| Length | 271 aa |
| Mass | 29.94 kD |
| ext | 46870 |
| pI | 8.81 |
| Name | Ferrichrome-binding protein precursor |
| Database References | UniProt |
| PFAM | PF01497 |
| PDB Structures | 3G9Q (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | YKAENGNVKIPKHPKRVVVMADGYYGYFKTLGINVVGAPENVFKNPYYKGKTNGVENIGDGTSVEKVIDLNPDLIIVWTTQGADIKKLEKIAPTVAVKYDKLDNIEQLKEFAKMTGTEDKAEKWLAKWDKKVAAAKTKIKKAVGDKTISIMQTNGKDIYVFGKDFGRGGSIIYKDLGLQATKLTKEKAIDQGPGYTSISLEKLPDFAGDYIFAGPWQSGGDDGGVFESSIWKNLNAVKNGHVYKMDPIGFYFTDPISLEGQLEFITESLTK |