| Read Date | 2008-05-08 12:37:00 |
|---|---|
| Read Number | X0000099400996200805081237 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8A_C1029 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Nicotinamide | 6.8 | 0.2 % (w/v) | c1cc(cnc1)C(=O)N |
| Congo Red | 6.8 | 0.2 % (w/v) | [Na+].[Na+].[O-]S(=O)(=O)… |
| Benzamidine hydrochloride | 6.8 | 0.2 % (w/v) | C1=CC=C(C=C1)C(=N)N.Cl |
| Salicin | 6.8 | 0.2 % (w/v) | c1ccc(c(c1)CO)O[C@H]2[C@@… |
| 6-Aminohexanoic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCCCCN |
![]() | SR577A |
|---|---|
| Spine Status | X-Ray structure |
| Length | 271 aa |
| Mass | 29.94 kD |
| ext | 46870 |
| pI | 8.81 |
| Name | Ferrichrome-binding protein precursor |
| Database References | UniProt |
| PFAM | PF01497 |
| PDB Structures | 3G9Q (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | YKAENGNVKIPKHPKRVVVMADGYYGYFKTLGINVVGAPENVFKNPYYKGKTNGVENIGDGTSVEKVIDLNPDLIIVWTTQGADIKKLEKIAPTVAVKYDKLDNIEQLKEFAKMTGTEDKAEKWLAKWDKKVAAAKTKIKKAVGDKTISIMQTNGKDIYVFGKDFGRGGSIIYKDLGLQATKLTKEKAIDQGPGYTSISLEKLPDFAGDYIFAGPWQSGGDDGGVFESSIWKNLNAVKNGHVYKMDPIGFYFTDPISLEGQLEFITESLTK |