| Read Date | 2008-05-09 07:21:00 |
|---|---|
| Read Number | X0000099411136200805090721 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8A_C1508 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Lithium sulfate monohydrate | 7.0 | 0.8 M | [Li+].[Li+].[O-]S([O-])(=… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | ZR314 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 280 aa |
| Mass | 32.17 kD |
| ext | 49850 |
| pI | 5.58 |
| Name | Similar to metal-dependent hydrolase |
| Database References | NCBI UniProt |
| PFAM | PF00753 |
| PDB Structures | 3ESH (Xray) |
| Gene | |
|---|---|
| Organism | Staphylococcus aureus |
| Genus | Staphylococcus |
| Species | aureus |
| Strain | |
| Sequence | MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPGIKMQHSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDDGENIDAYILRETLVDNN |