| Read Date | 2005-10-21 10:11:00 |
|---|---|
| Read Number | X0000059831368200510211011 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1050 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium phosphate monobasic monohydrate | 8.2 | 0.1 M | [Na+].[O-]P(=O)(O)O.O |
| Potassium phosphate dibasic anhydrous | 8.2 | 1.3 M | [K+].[K+].[O-]P([O-])(=O)… |
![]() | SR353 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 147 aa |
| Mass | 16.36 kD |
| ext | 5960 |
| pI | 4.78 |
| Name | Phage-like element PBSX protein xkdM |
| Database References | NCBI UniProt |
| PFAM | PF09393 |
| PDB Structures | 2GUJ (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MALKAQNTISGKEGRLFLDGEEMAHIKTFEANVEKNKSEVNIMGRRMTGHKTTGANGTGTATFYKVTSKFVLLMMDYVKKGSDPYFTLQAVLDDQSSGRGTERVTLYDVNFDSAKIASLDVDSEALEEEVPFTFEDFDVPEKLSDTF |