| Read Date | 2008-05-23 10:36:00 |
|---|---|
| Read Number | X0000099991281200805231036 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 8A_C0177 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.0 | 0.1 M | OCC(N)(CO)CO |
| Sodium nitrate | 8.0 | 2.6 M | [Na+].[O-][N+]([O-])=O |
![]() | LpR96D |
|---|---|
| Spine Status | HSQC collected |
| Length | 71 aa |
| Mass | 7.92 kD |
| ext | 9970 |
| pI | 4.61 |
| Name | Ribosomal protein S1 |
| Database References | UniProt |
| PFAM | PF00575 |
| PDB Structures | 4R71 (Best Match) |
| Gene | |
|---|---|
| Organism | Lactobacillus plantarum |
| Genus | Lactobacillus |
| Species | plantarum |
| Strain | |
| Sequence | EARKVWDDVEKEYEAGHTIKAPVTQVVKGGLVVDAGVRGFIPASMIDDHYVEDLNAYKGQELELKIIEIEP |