| Read Date | 2008-06-06 08:43:00 |
|---|---|
| Read Number | X0000100401504200806060843 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1528 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Tris | 8.5 | 0.1 M | OCC(N)(CO)CO |
| Potassium sodium tartrate tetrahydrate | 8.5 | 1.2 M | [K+].[Na+].O=C([O-])[C@H]… |
![]() | BhR169A |
|---|---|
| Spine Status | aggregation screening |
| Length | 195 aa |
| Mass | 21.16 kD |
| ext | 15470 |
| pI | 6.53 |
| Name | Glutamate synthase (Small subunit) |
| Database References | NCBI UniProt |
| PFAM | PF07992 |
| PDB Structures | 2VDC (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus halodurans |
| Genus | Bacillus |
| Species | halodurans |
| Strain | |
| Sequence | GKDVSAKQLKDDFDAVVLCTGATKPRDVNVKGRELKGIHFAMDFLTANTKSLLNSNHQDGNYISAKGKHVVVIGGGDTGADCITTSVRHGAKSITQFDINREKSNERPDNNPWPLFPIVHTVEDGHKEAAAVYGKDPRAYQVMTTKFVGDAEGHVKEIHTISVETTVHPDGSKTRVEIPGTEKVWPADLVFLAVG |