| Read Date | 2005-10-21 10:13:00 |
|---|---|
| Read Number | X0000059851288200510211013 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C1138 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| PEG 3350 | 7.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Sodium iodide | 7.0 | 0.2 M | [Na+].[I-] |
![]() | SR360 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 79 aa |
| Mass | 9.24 kD |
| ext | 4470 |
| pI | 4.55 |
| Name | YkuJ protein |
| Database References | NCBI UniProt |
| PFAM | PF08796 |
| PDB Structures | 2FFG (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MSQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYPFDNIDMVSIEIFELLQ |