| Read Date | 2008-06-06 09:19:00 |
|---|---|
| Read Number | X0000100411168200806060919 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1036 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Pyromellitic acid | 6.8 | 0.2 % (w/v) | O=C(O)c1cc(c(cc1C(=O)O)C(… |
| 3-Indolebutyric acid | 6.8 | 0.2 % (w/v) | C1=CC=C2C(=C1)C(=CN2)CCCC… |
| Hexadecanedioic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCCCCCCCCCCCCCC(=O)… |
| Oxamic acid | 6.8 | 0.2 % (w/v) | O=C(N)C(=O)O |
| Sebacic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCCCCCCCC(=O)O |
| Suberic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCCCCCC(=O)O |
![]() | ER542 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 168 aa |
| Mass | 18.68 kD |
| ext | 5960 |
| pI | 5.75 |
| Name | Putative lipoprotein yceB precursor |
| Database References | NCBI UniProt |
| PFAM | PF07273 |
| PDB Structures | 3L6I (Xray) |
| Gene | |
|---|---|
| Organism | Escherichia coli |
| Genus | Escherichia |
| Species | coli |
| Strain | |
| Sequence | MNQLTQYTITEQEINQSLAKHNNFSKDIGLPGVADAHIVLTNLTSQIGREEPNKVTLTGDANLDMNSLFGSQKATMKLKLKALPVFDKEKGAIFLKEMEVVDATVQPEKMQTVMQTLLPYLNQALRNYFNQQPAYVLREDGSQGEAMAKKLAKGIEVKPGEIVIPFTD |