 
    | Read Date | 2005-10-21 10:15:00 | 
|---|---|
| Read Number | X0000059851159200510211015 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0266 | 
| Screen | HWI Generation 6 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| HEPES | 7.5 | 0.1 M | [O-]S(=O)(=O)CCN1CC[NH+](… | 
| Potassium acetate | 7.5 | 0.1 M | CC(=O)[O-].[K+] | 
| PEG 20000 | 7.5 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
|  | SR360 | 
|---|---|
| Spine Status | X-Ray structure | 
| Length | 79 aa | 
| Mass | 9.24 kD | 
| ext | 4470 | 
| pI | 4.55 | 
| Name | YkuJ protein | 
| Database References | NCBI UniProt | 
| PFAM | PF08796 | 
| PDB Structures | 2FFG (Xray) | 
| Gene | |
|---|---|
| Organism | Bacillus subtilis | 
| Genus | Bacillus | 
| Species | subtilis | 
| Strain | |
| Sequence | MSQLMGIITRLQSLQETAEAANEPMQRYFEVNGEKICSVKYFEKNQTFELTVFQKGEKPNTYPFDNIDMVSIEIFELLQ |