| Read Date | 2008-06-20 11:40:00 |
|---|---|
| Read Number | X0000100881107200806201140 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0733 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| CAPS | 10.0 | 0.1 M | O=S(=O)(O)CCCNC1CCCCC1 |
| Potassium thiocyanate | 10.0 | 0.1 M | C(#N)[S-].[K+] |
| PEG 1000 | 10.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | VpR229 |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 122 aa |
| Mass | 13.99 kD |
| ext | 15470 |
| pI | 5.79 |
| Name | Putative (3R)-hydroxymyristoyl-(Acyl carrier protein) dehydratase |
| Database References | UniProt |
| PFAM | |
| PDB Structures | 3ESI (Best Match) |
| Gene | |
|---|---|
| Organism | Vibrio parahaemolyticus |
| Genus | Vibrio |
| Species | parahaemolyticus |
| Strain | |
| Sequence | MEKRKPTIQNIEVSDHTAELSLRVDADILDFQGHFSHFPLLPGVTQIDWALFYAVQYLNTPKVFKGMEVIKFQEPILPNADVCLSLSWDNEREKLTFKYTSKNGETLVTHSSGKMKLGESRE |