| Read Date | 2008-06-24 10:57:00 |
|---|---|
| Read Number | X0000100910232200806241057 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0982 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Sulfaguanidine | 6.8 | 0.2 % (w/v) | O=S(=O)(/N=C(\N)N)c1ccc(N… |
| p-Coumaric acid | 6.8 | 0.2 % (w/v) | c1cc(ccc1/C=C/C(=O)O)O |
| Phenylurea | 6.8 | 0.2 % (w/v) | O=C(Nc1ccccc1)N |
| Poly(3-hydroxybutyric acid) | 6.8 | 0.2 % (w/v) | O=C(O)CC(O)CC.O=C(O)CC(O)… |
![]() | HR5554A |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 165 aa |
| Mass | 18.84 kD |
| ext | 15470 |
| pI | 5.96 |
| Name | Enhancer of filamentation 1 (HEF1) (CRK-associated substrate-relatedprotein) (CAS-L) (CasL) (p105) (Protein NEDD9) (Renal carcinomaantigen NY-REN-12) |
| Database References | NCBI UniProt |
| PFAM | PF12026 |
| PDB Structures | 2L81 (NMR) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | DKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPGPGS |