| Read Date | 2008-07-22 09:55:00 |
|---|---|
| Read Number | X0000100910396200807220955 |
| Week | 5 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0987 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Gly-gly-gly-gly | 6.8 | 0.2 % (w/v) | O=C(NCC(=O)O)CNC(=O)CNC(=… |
| Ala-Ala | 6.8 | 0.2 % (w/v) | O=C(NC(C(=O)O)C)C(N)C |
| Ala-gly | 6.8 | 0.2 % (w/v) | O=C(NCC(=O)O)C(N)C |
| Leu-gly-gly | 6.8 | 0.2 % (w/v) | O=C(NCC(=O)O)CNC(=O)C(N)C… |
![]() | HR5554A |
|---|---|
| Spine Status | NMR structure and crystal hits |
| Length | 165 aa |
| Mass | 18.84 kD |
| ext | 15470 |
| pI | 5.96 |
| Name | Enhancer of filamentation 1 (HEF1) (CRK-associated substrate-relatedprotein) (CAS-L) (CasL) (p105) (Protein NEDD9) (Renal carcinomaantigen NY-REN-12) |
| Database References | NCBI UniProt |
| PFAM | PF12026 |
| PDB Structures | 2L81 (NMR) |
| Gene | |
|---|---|
| Organism | Homo sapiens |
| Genus | Homo |
| Species | sapiens |
| Strain | |
| Sequence | DKRLFLDPDTAIERLQRLQQALEMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELILHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPDDAKQLTTTINTNAEALFRPGPGS |