| Read Date | 2008-06-24 11:55:00 |
|---|---|
| Read Number | X0000100971315200806241155 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0749 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| CAPS | 10.0 | 0.1 M | O=S(=O)(O)CCCNC1CCCCC1 |
| Potassium phosphate dibasic anhydrous | 10.0 | 0.1 M | [K+].[K+].[O-]P([O-])(=O)… |
| PEG 1000 | 10.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | EwR179 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 129 aa |
| Mass | 14.64 kD |
| ext | 24980 |
| pI | 5.44 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF07977 |
| PDB Structures | 3ESI (Xray) |
| Gene | |
|---|---|
| Organism | Erwinia carotovora |
| Genus | Pectobacterium |
| Species | carotovorum |
| Strain | |
| Sequence | MLPVELVRHDVKKTDETSQVELMLQVDPDLFWFNGHFTGQPLLPGVAQLDWVMHYATTVLAQGWTFLSIENIKFQQPILPGKTLRLVLIWHAGKQSLTFSYSILEGDTERTASSGKIKLTPIMEDNPCQ |