| Read Date | 2008-07-07 10:24:00 |
|---|---|
| Read Number | X0000101421164200807071024 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1035 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| HEPES-Na | 6.8 | 0.0 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| HEPES-Na | 6.8 | 0.1 M | OCCN1CCN(CC1)CCS(=O)(=O)O… |
| PEG 3350 | 6.8 | 25.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Mellitic acid | 6.8 | 0.2 % (w/v) | O=C(O)c1c(c(c(c(c1C(=O)O)… |
| Azelaic acid | 6.8 | 0.2 % (w/v) | O=C(O)CCCCCCCC(=O)O |
| 2,2'-Thiodiglycolic acid | 6.8 | 0.2 % (w/v) | O=C(O)C(O)SC(O)C(=O)O |
| trans-Aconitic acid | 6.8 | 0.2 % (w/v) | O=C(O)\C(=C\C(=O)O)CC(=O)… |
![]() | RpR299 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 203 aa |
| Mass | 22.47 kD |
| ext | 36900 |
| pI | 5.11 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF13489 |
| PDB Structures | 3E23 (Xray) |
| Gene | |
|---|---|
| Organism | Rhodopseudomonas palustris |
| Genus | Rhodopseudomonas |
| Species | palustris |
| Strain | |
| Sequence | MEPDMTQAFDDDTLRFYRGNATAYAERQPRSATLTKFLGELPAGAKILELGCGAGYQAEAMLAAGFDVDATDGSPELAAEASRRLGRPVRTMLFHQLDAIDAYDAVWAHACLLHVPRDELADVLKLIWRALKPGGLFYASYKSGEGEGRDKLARYYNYPSEEWLRARYAEAGTWASVAVESSEGKGFDQELAQFLHVSVRKPE |