| Read Date | 2005-10-28 09:56:00 |
|---|---|
| Read Number | X0000060261458200510280956 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0953 |
| Screen | HWI Generation 6 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| CAPS | 10.0 | 0.1 M | O=S(=O)(O)CCCNC1CCCCC1 |
| Potassium thiocyanate | 10.0 | 0.1 M | C(#N)[S-].[K+] |
| PEG 400 | 10.0 | 20.0 % (v/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | SR375 |
|---|---|
| Spine Status | X-Ray structure |
| Length | 143 aa |
| Mass | 16.17 kD |
| ext | 2980 |
| pI | 5.25 |
| Name | Protein ymcA |
| Database References | NCBI UniProt |
| PFAM | PF06133 |
| PDB Structures | 2PIH (Xray) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MTLYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDALQEELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITSTGGDLLKGETGSKVKHSNNSCSL |