 
    | Read Date | 2005-10-28 09:58:00 | 
|---|---|
| Read Number | X0000060261313200510280958 | 
| Week | 0 | 
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 6_C0557 | 
| Screen | HWI Generation 6 | 
| Name | pH | Concentration | SMILES | 
|---|---|---|---|
| MOPS | 7.0 | 0.1 M | O=S(=O)(O)CCCN1CCOCC1 | 
| Ammonium phosphate dibasic | 7.0 | 0.1 M | [O-]P([O-])(=O)O.[NH4+].[… | 
| PEG 4000 | 7.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… | 
|  | SR375 | 
|---|---|
| Spine Status | X-Ray structure | 
| Length | 143 aa | 
| Mass | 16.17 kD | 
| ext | 2980 | 
| pI | 5.25 | 
| Name | Protein ymcA | 
| Database References | NCBI UniProt | 
| PFAM | PF06133 | 
| PDB Structures | 2PIH (Xray) | 
| Gene | |
|---|---|
| Organism | Bacillus subtilis | 
| Genus | Bacillus | 
| Species | subtilis | 
| Strain | |
| Sequence | MTLYSKKDIVQQARNLAKMISETEEVDFFKRAEAQINENDKVSTIVNQIKALQKQAVNLKHYEKHEALKQVEAKIDALQEELEEIPVIQEFRDSQMEVNDLLQLVAHTISNQVTNEIITSTGGDLLKGETGSKVKHSNNSCSL |