| Read Date | 2008-07-25 07:56:00 |
|---|---|
| Read Number | X0000102231496200807250756 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1526 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Potassium sodium tartrate tetrahydrate | 7.0 | 1.2 M | [K+].[Na+].O=C([O-])[C@H]… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | CgR113A |
|---|---|
| Spine Status | X-Ray structure |
| Length | 195 aa |
| Mass | 20.97 kD |
| ext | 40450 |
| pI | 4.80 |
| Name | SAM-dependent methyltransferase |
| Database References | NCBI UniProt |
| PFAM | PF13489 |
| PDB Structures | 3H2B (Xray) |
| Gene | |
|---|---|
| Organism | Corynebacterium glutamicum |
| Genus | Corynebacterium |
| Species | glutamicum |
| Strain | |
| Sequence | ATDDVSKAYSSPTFDAEALLGTVISAEDPDRVLIEPWATGVDGVILDVGSGTGRWTGHLASLGHQIEGLEPATRLVELARQTHPSVTFHHGTITDLSDSPKRWAGLLAWYSLIHMGPGELPDALVALRMAVEDGGGLLMSFFSGPSLEPMYHPVATAYRWPLPELAQALETAGFQVTSSHWDPRFPHAYLTAEAS |