| Read Date | 2008-07-25 08:28:00 |
|---|---|
| Read Number | X0000102241301200807250828 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0554 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Ammonium phosphate monobasic | 7.0 | 0.1 M | [O-]P(=O)(O)O.[NH4+] |
| PEG 4000 | 7.0 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
| Bis-Tris Propane | 7.0 | 0.1 M | OCC(NCCCNC(CO)(CO)CO)(CO)… |
![]() | BhR217B |
|---|---|
| Spine Status | crystal hits |
| Length | 221 aa |
| Mass | 25.21 kD |
| ext | 46870 |
| pI | 5.54 |
| Name | BH0355 protein |
| Database References | NCBI UniProt |
| PFAM | PF08241 |
| PDB Structures | 3BKW (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus halodurans |
| Genus | Bacillus |
| Species | halodurans |
| Strain | |
| Sequence | LPEYGPLAPSEEELHLFGDVDRLKVLEIGCGSGHSLKYLDEKQAGELWGIDLSTKQIEAAQTVLKDSKAPVTLFESPMEVNPGLPTDYFDIVFSIYALGWTTNLTKTLENVYRYLKPGGSFIFSWEHPMYNRVRQHQHGLTVDKSYHEEGAYAHEAWSSPAIMQQYRLSTYLNHLIDHGFKVERVIEDVCLADAQKHTNGWYGYEKAQMIPTTLIIKCLKQ |