| Read Date | 2008-07-25 08:29:00 |
|---|---|
| Read Number | X0000102261365200807250829 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0090 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium acetate trihydrate | 5.0 | 0.1 M | [Na+].[O-]C(=O)C.O.O.O |
| Manganese chloride tetrahydrate | 5.0 | 2.5 M | [Mn+2].[Cl-].[Cl-].O.O.O.… |
![]() | SR711 |
|---|---|
| Spine Status | crystal hits |
| Length | 255 aa |
| Mass | 28.35 kD |
| ext | 34950 |
| pI | 5.10 |
| Name | Uncharacterized protein ybaJ |
| Database References | UniProt |
| PFAM | PF08241 |
| PDB Structures | 3MER (Best Match) |
| Gene | |
|---|---|
| Organism | Bacillus subtilis |
| Genus | Bacillus |
| Species | subtilis |
| Strain | |
| Sequence | MNALVAHNSEAWDKKVETGNEWTVAVEQQVIEQAKKGNWDIRVTPMKDVPKDWFPPIKGLKVLCLASGGGQQGPVLAAAGADVTVLDNSEKQLNQDRMIAERDGLTIHTVKGSMDDLSVFNDESFDVIVHPVANVFVENVLPVWKEAYRVLKRNGILISGFVNPVVFLFDTVLEQQGVLKVKHSIPYADPEDLPKHKVKELIENNEALEFGHSLEDQIKGQIDAGFIVTGFYEDKGGFVLDQYIHTYSATRSVKV |