| Read Date | 2005-07-01 08:06:00 |
|---|---|
| Read Number | X0000052541449200507010806 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | crystal |
| 10-Way Classifier | clear |
| Cocktail | 5_C0183 |
| Screen | HWI Generation 5 |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| TAPS | 9.0 | 0.1 M | O=S(=O)(O)CCCNC(CO)(CO)CO |
| Sodium phosphate monobasic | 9.0 | 3.3 M | [Na+].[O-]P(=O)(O)O |
![]() | ER226 |
|---|---|
| Spine Status | NMR structure |
| Length | 118 aa |
| Mass | 13.52 kD |
| ext | 18450 |
| pI | 6.06 |
| Name | Protein yjbR |
| Database References | NCBI UniProt |
| PFAM | PF04237 |
| PDB Structures | 2FKI (NMR) |
| Gene | |
|---|---|
| Organism | Escherichia coli |
| Genus | Escherichia |
| Species | coli |
| Strain | |
| Sequence | MTISELLQYCMAKPGAEQSVHNDWKATQIKVEDVLFAMVKEVENRPAVSLKTSPELAELLRQQHSDVRPSRHLNKAHWSTVYLDGSLPDSQIYYLVDASYQQAVNLLPEEKRKLLVQL |