| Read Date | 2008-08-08 10:48:00 |
|---|---|
| Read Number | X0000102491256200808081048 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C1130 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium chloride | 5.0 | 1.0 M | [Na+].[Cl-] |
| Citric acid | 5.0 | 0.1 M | C(C(=O)O)C(CC(=O)O)(C(=O)… |
![]() | PlR178A |
|---|---|
| Spine Status | HSQC collected and crystal hits |
| Length | 112 aa |
| Mass | 12.64 kD |
| ext | 34490 |
| pI | 5.63 |
| Name | Single-strand binding protein, putative |
| Database References | NCBI UniProt |
| PFAM | PF00436 |
| PDB Structures | 3A5U (Best Match) |
| Gene | |
|---|---|
| Organism | Pseudomonas fluorescens |
| Genus | Pseudomonas |
| Species | fluorescens |
| Strain | |
| Sequence | MGTPVVWEGNIGNPPEHKSFPNGNNEPRQLLRLNVMFDNSIPDGSGGYKDRGGFWANVEWWHPDAERFAQLFSKGMRVVVTGRAIMDTWKDKETGDDVWALKVEANRVAILP |