| Read Date | 2008-08-18 09:49:00 |
|---|---|
| Read Number | X0000102791025200808180949 |
| Week | 0 |
| Verified Crystal | |
| 3-Way Classifier | |
| 10-Way Classifier | |
| Cocktail | 8A_C0449 |
| Screen | HWI Generation 8A |
| Name | pH | Concentration | SMILES |
|---|---|---|---|
| Sodium citrate tribasic dihydrate | 4.2 | 0.1 M | [Na+].[Na+].[Na+].O=C([O-… |
| Potassium phosphate dibasic anhydrous | 4.2 | 0.1 M | [K+].[K+].[O-]P([O-])(=O)… |
| PEG 8000 | 4.2 | 20.0 % (w/v) | C(CO)OC(CO)OC(CO)OC(CO)OC… |
![]() | DrR147D |
|---|---|
| Spine Status | NMR and X-Ray structures |
| Length | 146 aa |
| Mass | 16.19 kD |
| ext | 24980 |
| pI | 6.84 |
| Name | Putative uncharacterized protein |
| Database References | NCBI UniProt |
| PFAM | PF03364 |
| PDB Structures | 2KCZ (NMR) 3GGN (Xray) |
| Gene | |
|---|---|
| Organism | Deinococcus radiodurans |
| Genus | Deinococcus |
| Species | radiodurans |
| Strain | |
| Sequence | GETVVRDAVTIGKPAEQLYAVWRDLPGLPLLMTHLRSVEVLDDKRSRWTVEAPAPLGTVSWEAELTADEPGKRIAWRSLPGARIENSGEVLFRPAPGARGTEVVVRLTYRPPGGSAGAVIARMFNQEPSQQLRDDLMRFKREQELG |